1 of 1 pages analyzed
Doma
travely.xyz
blockchaindigital-asset-managementcryptocurrencynft-marketplacedecentralized-finance
0
AI-Readiness / 100
14 dead ends
Level 1 · Agent-Unreadable
Doma is a platform that allows users to explore, earn, trade, transfer, and launch various assets or projects.
14 dead ends are holding your score down. Close them to climb ↓
Shipped a fix? Re-audit to lock it in →Audit complete
ChatGPT, Claude, and Perplexity can't read travely.xyz.
Your homepage rendered, but with too little text for ChatGPT, Claude, or Perplexity to understand what the site is or does. Your AI-readiness score is 0 — but it's a fixable 0.
Most common causes
- A parked-domain lander or marketplace listing.
- A JavaScript-only shell that needs to execute before any text appears.
- A login wall hiding the public site from non-authenticated visitors.
What to do
Serve the homepage as HTML — server-rendered or static. Add a sitemap.xml of public pages. Then re-audit. Once we can read your content, you'll get a real score and an actionable fix list.
Fix list
14 to ship · 1 passing